PDB entry 1wrf

View 1wrf on RCSB PDB site
Description: Refined solution structure of Der f 2, The Major Mite Allergen from Dermatophagoides farinae
Class: allergen
Keywords: allergen, immunoglobulin fold
Deposited on 2004-10-15, released 2005-04-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mite group 2 allergen Der f 2
    Species: Dermatophagoides farinae [TaxId:6954]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00855 (0-128)
      • see remark 999 (75)
    Domains in SCOPe 2.06: d1wrfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wrfA (A:)
    dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
    leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
    iathgkird