PDB entry 1wrf

View 1wrf on RCSB PDB site
Description: Refined solution structure of Der f 2, The Major Mite Allergen from Dermatophagoides farinae
Class: allergen
Keywords: allergen, immunoglobulin fold
Deposited on 2004-10-15, released 2005-04-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-19, with a file datestamp of 2007-06-04.
Experiment type: NMR11
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mite group 2 allergen Der f 2
    Species: Dermatophagoides farinae
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00855 (0-128)
      • see remark 999 (75)
    Domains in SCOP 1.73: d1wrfa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wrfA (A:)
    dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
    leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
    iathgkird