PDB entry 1wr8

View 1wr8 on RCSB PDB site
Description: Crystal structure of hypothetical protein PH1421 from Pyrococcus horikoshii.
Class: Hydrolase
Keywords: alpha / beta core domain, had superfamily, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Hydrolase
Deposited on 2004-10-13, released 2004-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.197
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglycolate phosphatase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1421
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wr8a_
  • Chain 'B':
    Compound: Phosphoglycolate phosphatase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1421
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wr8b_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wr8A (A:)
    mkikaisididgtitypnrmihekaleairraeslgipimlvtgntvqfaeaasiligts
    gpvvaedggaisykkkriflasmdeewilwneirkrfpnartsytmpdrraglvimreti
    nvetvreiinelnlnlvavdsgfaihvkkpwinkgsgiekaseflgikpkevahvgdgen
    dldafkvvgykvavaqapkilkenadyvtkkeygeggaeaiyhilekfgyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wr8A (A:)
    kikaisididgtitypnrmihekaleairraeslgipimlvtgntvqfaeaasiligtsg
    pvvaedggaisykkkriflasmdeewilwneirkrfpnartsytmpdrraglvimretin
    vetvreiinelnlnlvavdsgfaihvkkpwinkgsgiekaseflgikpkevahvgdgend
    ldafkvvgykvavaqapkilkenadyvtkkeygeggaeaiyhilekfgyl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wr8B (B:)
    mkikaisididgtitypnrmihekaleairraeslgipimlvtgntvqfaeaasiligts
    gpvvaedggaisykkkriflasmdeewilwneirkrfpnartsytmpdrraglvimreti
    nvetvreiinelnlnlvavdsgfaihvkkpwinkgsgiekaseflgikpkevahvgdgen
    dldafkvvgykvavaqapkilkenadyvtkkeygeggaeaiyhilekfgyl