PDB entry 1wr5

View 1wr5 on RCSB PDB site
Description: Three dimensional Structure of the E41K mutant of Tetraheme Cytochrome c3 from Desulfovibrio vulgaris Miyazaki F
Class: electron transport
Keywords: tetraheme cytochrome c3, high resolution X-ray structure, E41K mutant, ELECTRON TRANSPORT
Deposited on 2004-10-11, released 2004-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c3
  Species: Desulfovibrio vulgaris [TaxId:883]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00132 (0-107)
    • engineered (41)
  Domains in SCOPe 2.08: d1wr5a_
• Heterogens: HEC, EOH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wr5A (A:)
  aapkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkkdyqkcatagchdnmdkkd
  ksakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs