PDB entry 1wr5

View 1wr5 on RCSB PDB site
Description: Three dimensional Structure of the E41K mutant of Tetraheme Cytochrome c3 from Desulfovibrio vulgaris Miyazaki F
Class: electron transport
Keywords: tetraheme cytochrome c3, high resolution X-ray structure, E41K mutant, ELECTRON TRANSPORT
Deposited on 2004-10-11, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.138
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00132 (0-107)
      • engineered (41)
    Domains in SCOPe 2.07: d1wr5a_
  • Heterogens: HEM, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wr5A (A:)
    aapkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkkdyqkcatagchdnmdkkd
    ksakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs