PDB entry 1wr3

View 1wr3 on RCSB PDB site
Description: Solution structure of the first WW domain of Nedd4-2
Class: ligase
Keywords: all-beta, LIGASE
Deposited on 2004-10-11, released 2005-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-protein ligase Nedd4-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CFI0 (2-35)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1wr3a1, d1wr3a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wr3A (A:)
    gspplppgweekvdnlgrtyyvnhnnrstqwhrpsl