PDB entry 1wr2

View 1wr2 on RCSB PDB site
Description: Crystal structure of PH1788 from Pyrococcus horikoshii Ot3
Deposited on 2004-10-08, released 2005-10-18
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.228
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH1789
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wr2A (A:)
    mkeeavrvieevlkqgrtamveyeakqvlkayglpvpeeklaktldealeyakeigypvv
    lklmspqilhksdakvvmlnikneeelkkkweeihenakkyrpdaeilgvlvapmlkpgr
    eviigvtedpqfghaimfglggifveilkdvtfrlvpitekdarkmiqeikaypilagar
    geepadidaivdmllkvsklvddlkdyikemdlnpvfvynkgegavivdsriilkpkd
    

    Sequence, based on observed residues (ATOM records):
    >1wr2A (A:)
    mkeeavrvieevlkqgrtamveyeakqvlkayglpvpeeklaktldealeyakeigypvv
    lklmspqilhksdakvvmlnikneeelkkkweeihenakkyrpdaeilgvlvapmlkpgr
    eviigvtedpqfghaimfglggifveilkdvtfrlvpitekdarkmiqeikaypilagae
    epadidaivdmllkvsklvddlkdyikemdlnpvfvynkgegavivdsriilkpk