PDB entry 1wr1

View 1wr1 on RCSB PDB site
Description: The complex sturcture of Dsk2p UBA with ubiquitin
Class: signaling protein
Keywords: uba domain, uba-ubiquitin complex, dsk2
Deposited on 2004-10-08, released 2005-04-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-19, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin
  Species: Saccharomyces cerevisiae
  Gene: UBI4 (1224-1451)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61864 (0-75)
  Domains in SCOP 1.73: d1wr1a1
• Chain 'B':
  Compound: ubiquitin-like protein dsk2
  Species: Saccharomyces cerevisiae
  Gene: DSK2 (982-1120)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48510 (12-57)
    • cloning artifact (0-11)
  Domains in SCOP 1.73: d1wr1b1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wr1A (A:)
  mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
  iqkestlhlvlrlrgg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wr1B (B:)
  pgisgggggildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv