PDB entry 1wr0

View 1wr0 on RCSB PDB site
Description: Structural characterization of the MIT domain from human Vps4b
Class: protein transport
Keywords: VPS4b, SKD1, MIT DOMAIN, ESCORT, MVB, SNPs, PROTEIN TRANSPORT, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-10-07, released 2005-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SKD1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75351 (4-80)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d1wr0a1, d1wr0a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wr0A (A:)
    gsdhmsstspnlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakq
    sirakcteyldraeklkeylk