PDB entry 1wqs

View 1wqs on RCSB PDB site
Description: Crystal structure of Norovirus 3C-like protease
Class: hydrolase
Keywords: crystal structure, norovirus, 3c-like protease, chymotrypsin like protease, oxyanion hole, norwalk-like virus, hydrolase
Deposited on 2004-10-01, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.206
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like protease
    Species: Norwalk virus [TaxId:99565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wqsa_
  • Chain 'B':
    Compound: 3C-like protease
    Species: Norwalk virus [TaxId:99565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wqsb_
  • Chain 'C':
    Compound: 3C-like protease
    Species: Norwalk virus [TaxId:99565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wqsc_
  • Chain 'D':
    Compound: 3C-like protease
    Species: Norwalk virus [TaxId:99565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wqsd_
  • Heterogens: HG, TLA, TAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wqsA (A:)
    apptlwsrvvrfgsgwgfwvsptvfittthviptgvreffgepiesiaihrageftqfrf
    srkvrpdltgmvleegcpegvvcsilikrdsgellplavrmgaiasmkiqgrlvhgqsgm
    lltganakgmdlgtlpgdcgapyvykrnndwvvcgvhaaatksgntvvcavqa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wqsB (B:)
    apptlwsrvvrfgsgwgfwvsptvfittthviptgvreffgepiesiaihrageftqfrf
    srkvrpdltgmvleegcpegvvcsilikrdsgellplavrmgaiasmkiqgrlvhgqsgm
    lltganakgmdlgtlpgdcgapyvykrnndwvvcgvhaaatksgntvvcavqa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wqsC (C:)
    apptlwsrvvrfgsgwgfwvsptvfittthviptgvreffgepiesiaihrageftqfrf
    srkvrpdltgmvleegcpegvvcsilikrdsgellplavrmgaiasmkiqgrlvhgqsgm
    lltganakgmdlgtlpgdcgapyvykrnndwvvcgvhaaatksgntvvcavqa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wqsD (D:)
    apptlwsrvvrfgsgwgfwvsptvfittthviptgvreffgepiesiaihrageftqfrf
    srkvrpdltgmvleegcpegvvcsilikrdsgellplavrmgaiasmkiqgrlvhgqsgm
    lltganakgmdlgtlpgdcgapyvykrnndwvvcgvhaaatksgntvvcavqa