PDB entry 1wqp

View 1wqp on RCSB PDB site
Description: contribution of hydrogen bonds to the conformational stability of human lysozyme
Class: hydrolase
Keywords: hydrolase (o-glycosyl), glycosidase, bacteriolytic enzyme
Deposited on 1998-02-09, released 1998-07-01
The last revision prior to the SCOP 1.75 freeze date was dated 1998-07-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (44)
    Domains in SCOP 1.75: d1wqpa_
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wqpA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnfnagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv