PDB entry 1wql

View 1wql on RCSB PDB site
Description: Cumene dioxygenase (cumA1A2) from Pseudomonas fluorescens IP01
Class: oxidoreductase
Keywords: biphenyl dioxygenase, cumene dioxygenase, naphthalene dioxygenase, polychlorinated biphenyl degradation, Rieske non-heme iron dioxygenase, OXIDOREDUCTASE
Deposited on 2004-09-30, released 2005-03-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.173
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: iron-sulfur protein large subunit of cumene dioxygenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: CUMA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wqla1, d1wqla2
  • Chain 'B':
    Compound: ethylbenzene dioxygenase small subunit
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: CUMA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wqlb1
  • Heterogens: FE2, FES, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wqlA (A:)
    mssiinkevqeaplkwvknwsdeeikalvdeekglldprifsdqdlyeielervfarswl
    llgheghipkagdylttymgedpvivvrqkdrsikvflnqcrhrgmriersdfgnaksft
    ctyhgwaydtagnlvnvpyekeafcdkkegdcgfdkadwgplqarvdtykglifanwdte
    apdlktylsdatpymdvmldrteavtqvitgmqktvipcnwkfaaeqfcsdmyhagtmah
    lsgvlsslppemdlsqvklpssgnqfrakwgghgtgwfnddfallqaimgpkvvdywtkg
    paaerakerlgkvlpadrmvaqhmtifptcsflpgintvrtwhprgpneievwsfivvda
    dapedikeeyrrkniftfnqggtyeqddgenwvevqrglrgykarsrplcaqmgagvpnk
    nnpefpgktsyvyseeaargfyhhwsrmmsepswdtlks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wqlA (A:)
    nwsdeeikalvdeekglldprifsdqdlyeielervfarswlllgheghipkagdyltty
    mgedpvivvrqkdrsikvflnqcrhrgmriersdfgnaksftctyhgwaydtagnlvnvp
    yekeafcdcgfdkadwgplqarvdtykglifanwdteapdlktylsdatpymdvmldrte
    avtqvitgmqktvipcnwkfaaeqfcsdmyhagtmahlsgvlsslppemdlsqvklpssg
    nqfrakwgghgtgwfnddfallqaimgpkvvdywtkgpaaerakerlgkvlpadrmvaqh
    mtifptcsflpgintvrtwhprgpneievwsfivvdadapedikeeyrrkniftfnqggt
    yeqddgenwvevqrglrgykarsrplcaqmgagvpnknnpefpgktsyvyseeaargfyh
    hwsrmmsepswdtlks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wqlB (B:)
    mtsadltkpiewpempvslelqnaveqfyyreaqlldyqnyeawlalltqdiqywmpirt
    thtsrnkameyvppggnahfdetyesmrarirarvsglnwtedppsrsrhivsnvivret
    esagtlevssaflcyrnrlermtdiyvgerrdillrvsdglgfkiakrtilldqstitan
    nlsqff
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wqlB (B:)
    dltkpiewpempvslelqnaveqfyyreaqlldyqnyeawlalltqdiqywmpirtthts
    rnkameyvppggnahfdetyesmrarirarvsglnwtedppsrsrhivsnvivretesag
    tlevssaflcyrnrlermtdiyvgerrdillrvsdglgfkiakrtilldqstitannlsq
    ff