PDB entry 1wqi

View 1wqi on RCSB PDB site
Description: Solution structure of RSGI RUH-028, a homeobox domain from human cDNA
Class: structural genomics, unknown function
Keywords: DNA-binding protein, helix-turn-helix, transcriptional regulatory factor, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2004-09-29, released 2005-03-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2006-11-14, with a file datestamp of 2007-06-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein PRH
    Species: HOMO SAPIENS
    Gene: BC050638
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03014 (7-63)
      • cloning artifact (0-6)
      • cloning artifact (64-69)
    Domains in SCOPe 2.08: d1wqia1, d1wqia2, d1wqia3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wqiA (A:)
    gssgssgkggqvrfsndqtielekkfetqkylspperkrlakmlqlserqvktwfqnrra
    kwrrsgpssg