PDB entry 1wqb

View 1wqb on RCSB PDB site
Description: Three-dimensional Solution Strucutre of Aptotoxin VII, from the venom of a Trap-door Spider
Deposited on 2004-09-27, released 2005-12-13
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aptotoxin VII
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wqbA (A:)
    wlgcarvkeacgpwewpccsglkcdgsechpq