PDB entry 1wqa

View 1wqa on RCSB PDB site
Description: Crystal Structure of Pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with Mg2+
Deposited on 2004-09-24, released 2005-10-04
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospho-sugar mutase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0923
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: phospho-sugar mutase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0923
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: phospho-sugar mutase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0923
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: phospho-sugar mutase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0923
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wqaA (A:)
    mgklfgtfgvrgianekitpefamkigmafgtllkregrkkplvvvgrdtrvsgemlkea
    lisgllsvgcdvidvgiaptpavqwatkhfnadggavitashnppeyngikllepngmgl
    kkereaiveelffkedfdrakwyeigevrrediikpyieaikskvdveaikkrkpfvvvd
    tsngagsltlpyllrelgckvitvnaqpdgyfparnpepneenlkefmeivkalgadfgv
    aqdgdadravfidengrfiqgdktfalvadavlkekgggllvttvatsnllddiakkhga
    kvmrtkvgdlivaralyenngtiggeenggvifpehvlgrdgamtvakvveifaksgkkf
    selidelpkyyqiktkrhvegdrhaivnkvaemarergytvdttdgakiifedgwvlvra
    sgtepiirifseakskekaqeylnlgiellekals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1wqaB (B:)
    mgklfgtfgvrgianekitpefamkigmafgtllkregrkkplvvvgrdtrvsgemlkea
    lisgllsvgcdvidvgiaptpavqwatkhfnadggavitashnppeyngikllepngmgl
    kkereaiveelffkedfdrakwyeigevrrediikpyieaikskvdveaikkrkpfvvvd
    tsngagsltlpyllrelgckvitvnaqpdgyfparnpepneenlkefmeivkalgadfgv
    aqdgdadravfidengrfiqgdktfalvadavlkekgggllvttvatsnllddiakkhga
    kvmrtkvgdlivaralyenngtiggeenggvifpehvlgrdgamtvakvveifaksgkkf
    selidelpkyyqiktkrhvegdrhaivnkvaemarergytvdttdgakiifedgwvlvra
    sgtepiirifseakskekaqeylnlgiellekals
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1wqaC (C:)
    mgklfgtfgvrgianekitpefamkigmafgtllkregrkkplvvvgrdtrvsgemlkea
    lisgllsvgcdvidvgiaptpavqwatkhfnadggavitashnppeyngikllepngmgl
    kkereaiveelffkedfdrakwyeigevrrediikpyieaikskvdveaikkrkpfvvvd
    tsngagsltlpyllrelgckvitvnaqpdgyfparnpepneenlkefmeivkalgadfgv
    aqdgdadravfidengrfiqgdktfalvadavlkekgggllvttvatsnllddiakkhga
    kvmrtkvgdlivaralyenngtiggeenggvifpehvlgrdgamtvakvveifaksgkkf
    selidelpkyyqiktkrhvegdrhaivnkvaemarergytvdttdgakiifedgwvlvra
    sgtepiirifseakskekaqeylnlgiellekals
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1wqaD (D:)
    mgklfgtfgvrgianekitpefamkigmafgtllkregrkkplvvvgrdtrvsgemlkea
    lisgllsvgcdvidvgiaptpavqwatkhfnadggavitashnppeyngikllepngmgl
    kkereaiveelffkedfdrakwyeigevrrediikpyieaikskvdveaikkrkpfvvvd
    tsngagsltlpyllrelgckvitvnaqpdgyfparnpepneenlkefmeivkalgadfgv
    aqdgdadravfidengrfiqgdktfalvadavlkekgggllvttvatsnllddiakkhga
    kvmrtkvgdlivaralyenngtiggeenggvifpehvlgrdgamtvakvveifaksgkkf
    selidelpkyyqiktkrhvegdrhaivnkvaemarergytvdttdgakiifedgwvlvra
    sgtepiirifseakskekaqeylnlgiellekals