PDB entry 1wq9
View 1wq9 on RCSB PDB site
Description: Crystal structure of VR-1, a VEGF-F from a snake venom
Class: toxin
Keywords: Snake venom, Vascular endothelial growth factor, VEGF, VEGF-F, TOXIN
Deposited on
2004-09-24, released
2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: vascular endothelial growth factor
Species: Daboia russellii russellii [TaxId:31159]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1wq9a_ - Chain 'B':
Compound: vascular endothelial growth factor
Species: Daboia russellii russellii [TaxId:31159]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1wq9b_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1wq9A (A:)
evrpfldvyqrsacqtretlvsilqehpdeisdifrpscvavlrcsgcctdesmkctpvg
khtadiqimrmnprthsskmevmkfmehtacecrpa
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1wq9B (B:)
evrpfldvyqrsacqtretlvsilqehpdeisdifrpscvavlrcsgcctdesmkctpvg
khtadiqimrmnprthsskmevmkfmehtacecrpa