PDB entry 1wq9

View 1wq9 on RCSB PDB site
Description: Crystal structure of VR-1, a VEGF-F from a snake venom
Class: toxin
Keywords: Snake venom, Vascular endothelial growth factor, VEGF, VEGF-F, TOXIN
Deposited on 2004-09-24, released 2004-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vascular endothelial growth factor
  Species: Daboia russellii russellii [TaxId:31159]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P67861 (1-94)
  Domains in SCOPe 2.08: d1wq9a_
• Chain 'B':
  Compound: vascular endothelial growth factor
  Species: Daboia russellii russellii [TaxId:31159]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P67861 (1-94)
  Domains in SCOPe 2.08: d1wq9b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wq9A (A:)
  evrpfldvyqrsacqtretlvsilqehpdeisdifrpscvavlrcsgcctdesmkctpvg
  khtadiqimrmnprthsskmevmkfmehtacecrpa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wq9B (B:)
  evrpfldvyqrsacqtretlvsilqehpdeisdifrpscvavlrcsgcctdesmkctpvg
  khtadiqimrmnprthsskmevmkfmehtacecrpa