PDB entry 1wq8

View 1wq8 on RCSB PDB site
Description: Crystal structure of Vammin, a VEGF-F from a snake venom
Class: toxin
Keywords: snake venom, Vascular endothelial growth factor, VEGF, VEGF-F
Deposited on 2004-09-23, released 2004-12-07
The last revision prior to the SCOP 1.73 freeze date was dated 2004-12-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular endothelial growth factor toxin
    Species: Vipera aspis aspis
    Domains in SCOP 1.73: d1wq8a_
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wq8A (A:)
    evrpflevhersacqaretlvpilqeypdeisdifrpscvavlrcsgcctdeslkctpvg
    khtvdiqimrvnprtqsskmevmkftehtacecrprrkqgepdgpkekpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wq8A (A:)
    evrpflevhersacqaretlvpilqeypdeisdifrpscvavlrcsgcctdeslkctpvg
    khtvdiqimrvnprtqsskmevmkftehtacecrprrkqg