PDB entry 1wq7

View 1wq7 on RCSB PDB site
Description: Crystal Structure Of Biotin-(Acetyl-CoA-Carboxylase) ligase From Pyrococcus Horikoshii Ot3
Class: ligase
Keywords: Biotin Biosynthesis, Dimer, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2004-09-23, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.216
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: birA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wq7a1, d1wq7a2
  • Chain 'B':
    Compound: biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: birA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wq7b1, d1wq7b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wq7A (A:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wq7A (A:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgespegglwlsivl
    spkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegkgdkivl
    giglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdilnlvrdnm
    ilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wq7B (B:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wq7B (B:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmgespegglwlsivlsp
    kvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegkgdkivlgi
    glnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdilnlvrdnmil
    gvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl