PDB entry 1wq6

View 1wq6 on RCSB PDB site
Description: The tetramer structure of the nervy homolgy two (NHR2) domain of AML1-ETO is critical for AML1-ETO'S activity
Deposited on 2004-09-23, released 2005-10-04
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aml1-eto
    Species: Homo sapiens [TaxId:9606]
    Gene: AML1/ETO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06455
      • modified residue (33)
      • modified residue (35)
  • Chain 'B':
    Compound: aml1-eto
    Species: Homo sapiens [TaxId:9606]
    Gene: AML1/ETO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06455
      • modified residue (33)
      • modified residue (35)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wq6A (A:)
    amatrqeemidhrltdrewaeewkhldhllncimdmvektrrsltvlrrcqeadreelny
    wirrysdaedlk
    

    Sequence, based on observed residues (ATOM records):
    >1wq6A (A:)
    dhrltdrewaeewkhldhllncimdmvektrrsltvlrrcqeadreelnywirrysdae
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wq6B (B:)
    amatrqeemidhrltdrewaeewkhldhllncimdmvektrrsltvlrrcqeadreelny
    wirrysdaedlk
    

    Sequence, based on observed residues (ATOM records):
    >1wq6B (B:)
    dhrltdrewaeewkhldhllncimdmvektrrsltvlrrcqeadreelnywirrysdae