PDB entry 1wq5

View 1wq5 on RCSB PDB site
Description: Crystal structure of tryptophan synthase alpha-subunit from Escherichia coli
Class: lyase
Keywords: Tryptophan synthase, tryptophan, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LYASE
Deposited on 2004-09-22, released 2005-02-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.185
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wq5a_
  • Chain 'B':
    Compound: tryptophan synthase alpha chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wq5b_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wq5A (A:)
    meryeslfaqlkerkegafvpfvtlgdpgieqslkiidtlieagadalelgipfsdplad
    gptiqnatlrafaagvtpaqcfemlalirqkhptipigllmyanlvfnkgidefyaqcek
    vgvdsvlvadvpveesapfrqaalrhnvapificppnadddllrqiasygrgytyllsra
    gvtgaenraalplnhlvaklkeynaapplqgfgisapdqvkaaidagaagaisgsaivki
    ieqhinepekmlaalkvfvqpmkaatrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wq5A (A:)
    meryeslfaqlkerkegafvpfvtlgdpgieqslkiidtlieagadalelgipfsdqnat
    lrafaagvtpaqcfemlalirqkhptipigllmyanlvfnkgidefyaqcekvgvdsvlv
    advpveesapfrqaalrhnvapificppnadddllrqiasygrgytyllsragvtenraa
    lplnhlvaklkeynaapplqgfgisapdqvkaaidagaagaisgsaivkiieqhinepek
    mlaalkvfvqpmkaatrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wq5B (B:)
    meryeslfaqlkerkegafvpfvtlgdpgieqslkiidtlieagadalelgipfsdplad
    gptiqnatlrafaagvtpaqcfemlalirqkhptipigllmyanlvfnkgidefyaqcek
    vgvdsvlvadvpveesapfrqaalrhnvapificppnadddllrqiasygrgytyllsra
    gvtgaenraalplnhlvaklkeynaapplqgfgisapdqvkaaidagaagaisgsaivki
    ieqhinepekmlaalkvfvqpmkaatrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wq5B (B:)
    meryeslfaqlkerkegafvpfvtlgdpgieqslkiidtlieagadalelgipfsdpliq
    natlrafaagvtpaqcfemlalirqkhptipigllmyanlvfnkgidefyaqcekvgvds
    vlvadvpveesapfrqaalrhnvapificppnadddllrqiasygrgytyllsragvten
    raalplnhlvaklkeynaapplqgfgisapdqvkaaidagaagaisgsaivkiieqhine
    pekmlaalkvfvqpmkaatrs