PDB entry 1wq2

View 1wq2 on RCSB PDB site
Description: Neutron Crystal Structure Of Dissimilatory Sulfite Reductase D (DsrD)
Class: unknown function
Keywords: neutron hydrogen hydration protein, UNKNOWN FUNCTION
Deposited on 2004-09-19, released 2005-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NEUT
Resolution: 2.4 Å
R-factor: 0.229
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein dsvD
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wq2a_
  • Chain 'B':
    Compound: Protein dsvD
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wq2b_
  • Heterogens: SO4, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wq2A (A:)
    meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst
    tmyglkgagkqaaaehed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wq2A (A:)
    meeakqkvvdflnsskfyfndftdlfpdmkqrevkkiltalvndevleywssgsttmygl
    kgagk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wq2B (B:)
    meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst
    tmyglkgagkqaaaehed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wq2B (B:)
    meeakqkvvdflnskskskfyfndftdlfpdmkqrevkkiltalvndevleywssgsttm
    yglkga