PDB entry 1wpx

View 1wpx on RCSB PDB site
Description: Crystal structure of carboxypeptidase Y inhibitor complexed with the cognate proteinase
Class: Hydrolase
Keywords: Carboxypeptidase inhibitor, serine proteinase inhibitor, proteinase-inhibitor complex, phosphatidylethanolamine-binding protein, phospholipid, Hydrolase
Deposited on 2004-09-14, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.183
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxypeptidase Y
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpxa_
  • Chain 'B':
    Compound: Carboxypeptidase Y inhibitor
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpxb1
  • Heterogens: NAG, NDG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wpxA (A:)
    kikdpkilgidpnvtqytgyldvededkhfffwtfesrndpakdpvilwlnggpgcsslt
    glffelgpssigpdlkpignpyswnsnatvifldqpvnvgfsysgssgvsntvaagkdvy
    nflelffdqfpeyvnkgqdfhiagesyaghyipvfaseilshkdrnfnltsvligngltd
    pltqynyyepmacgeggepsvlpseecsamedslerclgliescydsqsvwscvpatiyc
    nnaqlapyqrtgrnvydirkdceggnlcyptlqdiddylnqdyvkeavgaevdhyescnf
    dinrnflfagdwmkpyhtavtdllnqdlpilvyagdkdficnwlgnkawtdvlpwkydee
    fasqkvrnwtasitdevagevksykhftylrvfngghmvpfdvpenalsmvnewihggfs
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wpxB (B:)
    mnqaidfaqasidsykkhgiledvihdtsfqpsgilaveysssapvamgntlptekarsk
    pqfqftfnkqmqksvpqanayvpqdddlftlvmtdpdapsktdhkwsefchlvecdlkll
    neathetsgateffasefntkgsntlieymgpappkgsgphryvfllykqpkgvdsskfs
    kikdrpnwgygtpatgvgkwakennlqlvasnffyaetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpxB (B:)
    mnqaidfaqasidsykkhgiledvihdtsfqpsgilaveysssapvamgntlptekarsk
    pqfqftfnkqmqnayvpqdddlftlvmtdpdapsktdhkwsefchlvecdlkllnteffa
    sefntkgsntlieymgpappkgsgphryvfllykqpkgvdsskfskikdrpnwgygtpat
    gvgkwakennlqlvasnffyaetk