PDB entry 1wpw

View 1wpw on RCSB PDB site
Description: Crystal Structure of IPMDH from Sulfolobus tokodaii
Class: Oxidoreductase
Keywords: Oxidoreductase
Deposited on 2004-09-14, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.19
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wpwa_
  • Chain 'B':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wpwb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wpwA (A:)
    gftvaliqgdgigpeivskskrilakinelyslpieyieveagdralarygealpkdslk
    iidkadiilkgpvgesaadvvvklrqiydmyanirpaksipgidtkygnvdilivrente
    dlykgfehivsdgvavgmkiitrfaseriakvglnfalrrrkkvtcvhkanvmritdglf
    aeacrsvlkgkveysemyvdaaaanlvrnpqmfdvivtenvygdilsdeasqiagslgia
    psanigdkkalfepvhgaafdiagknignptafllsvsmmyermyelsnddryikasral
    enaiylvykerkaltpdvggnattddlineiynklg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wpwB (B:)
    gftvaliqgdgigpeivskskrilakinelyslpieyieveagdralarygealpkdslk
    iidkadiilkgpvgesaadvvvklrqiydmyanirpaksipgidtkygnvdilivrente
    dlykgfehivsdgvavgmkiitrfaseriakvglnfalrrrkkvtcvhkanvmritdglf
    aeacrsvlkgkveysemyvdaaaanlvrnpqmfdvivtenvygdilsdeasqiagslgia
    psanigdkkalfepvhgaafdiagknignptafllsvsmmyermyelsnddryikasral
    enaiylvykerkaltpdvggnattddlineiynklg