PDB entry 1wpv

View 1wpv on RCSB PDB site
Description: Crystal Structure of Activated Binary complex of HutP, an RNA binding anti-termination protein
Class: RNA binding protein
Keywords: HutP, RNA binding, Antitermination, Transcription regulation, L-histidine, Conformational change, Allosteric activation
Deposited on 2004-09-14, released 2005-03-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.233
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hut operon positive regulatory protein
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10943 (0-146)
      • engineered (49)
    Domains in SCOP 1.75: d1wpva1
  • Chain 'B':
    Compound: Hut operon positive regulatory protein
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10943 (0-146)
      • engineered (49)
    Domains in SCOP 1.75: d1wpvb1
  • Chain 'C':
    Compound: Hut operon positive regulatory protein
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10943 (0-146)
      • engineered (49)
    Domains in SCOP 1.75: d1wpvc1
  • Heterogens: MG, HIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wpvA (A:)
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wpvB (B:)
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wpvC (C:)
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi