PDB entry 1wpu

View 1wpu on RCSB PDB site
Description: Crystal Structure of the HutP antitermination complex bound to a single stranded region of hut mRNA
Class: transcription/RNA
Keywords: HutP, RNA binding, HutP-RNA complex, Antitermination, Transcription regulation
Deposited on 2004-09-13, released 2005-08-30
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.214
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hut operon positive regulatory protein
  Species: Bacillus subtilis
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10943 (0-146)
    • engineered (49)
  Domains in SCOP 1.75: d1wpua1
• Chain 'B':
  Compound: Hut operon positive regulatory protein
  Species: Bacillus subtilis
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10943 (0-146)
    • engineered (49)
  Domains in SCOP 1.75: d1wpub1
• Chain 'C':
  Compound: 5'-r(*up*up*gp*ap*gp*up*u)-3'
  
• Chain 'D':
  Compound: 5'-r(*up*up*gp*ap*gp*up*u)-3'
  
• Heterogens: MG, HIS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wpuA (A:)
  tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
  gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
  avslygtigapikglehetfgvginhi
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wpuB (B:)
  tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
  gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
  avslygtigapikglehetfgvginhi
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.