PDB entry 1wps

View 1wps on RCSB PDB site
Description: Crystal Structure of HutP, an RNA binding anti-termination protein
Class: RNA binding protein
Keywords: HutP, RNA binding, Antitermination, Transcription regulation, RNA BINDING PROTEIN
Deposited on 2004-09-13, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hut operon positive regulatory protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10943 (Start-146)
      • engineered (49)
    Domains in SCOPe 2.07: d1wpsa_
  • Chain 'B':
    Compound: Hut operon positive regulatory protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10943 (Start-146)
      • engineered (49)
    Domains in SCOPe 2.07: d1wpsb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wpsA (A:)
    tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
    gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
    avslygtigapikglehetfgvginhi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpsA (A:)
    errigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskksgviq
    segyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavsl
    ygtigapikglehetfgvginhi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wpsB (B:)
    tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
    gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
    avslygtigapikglehetfgvginhi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpsB (B:)
    kerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskksgvi
    qsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavs
    lygtigapikglehetfgvginhi