PDB entry 1wpr

View 1wpr on RCSB PDB site
Description: Crystal structure of RsbQ inhibited by PMSF
Class: signaling protein
Keywords: alpha/beta hydrolase, SIGNALING PROTEIN
Deposited on 2004-09-11, released 2005-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.231
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sigma factor sigB regulation protein rsbQ
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rsbq
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07015 (6-270)
      • cloning artifact (1-5)
    Domains in SCOPe 2.08: d1wpra1, d1wpra2
  • Chain 'B':
    Compound: Sigma factor sigB regulation protein rsbQ
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rsbq
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07015 (6-270)
      • cloning artifact (1-5)
    Domains in SCOPe 2.08: d1wprb1, d1wprb2
  • Heterogens: PMS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wprA (A:)
    aghmtsilsrnhvkvkgsgkasimfapgfgcdqsvwnavapafeedhrvilfdyvgsghs
    dlraydlnryqtldgyaqdvldvcealdlketvfvghsvgaligmlasirrpelfshlvm
    vgpspcylndppeyyggfeeeqllgllemmeknyigwatvfaatvlnqpdrpeikeeles
    rfcstdpviarqfakaaffsdhredlskvtvpslilqcaddiiapatvgkymhqhlpyss
    lkqmearghcphmshpdetiqligdylkahv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wprA (A:)
    ghmtsilsrnhvkvkgsgkasimfapgfgcdqsvwnavapafeedhrvilfdyvgsghsd
    lydlnryqtldgyaqdvldvcealdlketvfvghsvgaligmlasirrpelfshlvmvgp
    spcylndppeyyggfeeeqllgllemmeknyigwatvfaatvlnqpdrpeikeelesrfc
    stdpviarqfakaaffsdhredlskvtvpslilqcaddiiapatvgkymhqhlpysslkq
    mearghcphmshpdetiqligdylkahv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wprB (B:)
    aghmtsilsrnhvkvkgsgkasimfapgfgcdqsvwnavapafeedhrvilfdyvgsghs
    dlraydlnryqtldgyaqdvldvcealdlketvfvghsvgaligmlasirrpelfshlvm
    vgpspcylndppeyyggfeeeqllgllemmeknyigwatvfaatvlnqpdrpeikeeles
    rfcstdpviarqfakaaffsdhredlskvtvpslilqcaddiiapatvgkymhqhlpyss
    lkqmearghcphmshpdetiqligdylkahv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wprB (B:)
    ghmtsilsrnhvkvkgsgkasimfapgfgcdqsvwnavapafeedhrvilfdyvgsghyd
    lnryqtldgyaqdvldvcealdlketvfvghsvgaligmlasirrpelfshlvmvgpspc
    ylndppeyyggfeeeqllgllemmeknyigwatvfaatvlnqpdrpeikeelesrfcstd
    pviarqfakaaffsdhredlskvtvpslilqcaddiiapatvgkymhqhlpysslkqmea
    rghcphmshpdetiqligdylkahv