PDB entry 1wpq

View 1wpq on RCSB PDB site
Description: Ternary Complex Of Glycerol 3-phosphate Dehydrogenase 1 with NAD and dihydroxyactone
Class: Oxidoreductase
Keywords: NAD, GPD1, DEHYDROGENASE, DIHYDROXYACTONE COMPLEX, Oxidoreductase
Deposited on 2004-09-10, released 2006-04-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.258
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1wpqa1, d1wpqa2
  • Chain 'B':
    Compound: Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1wpqb1, d1wpqb2
  • Heterogens: SO4, 13P, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wpqA (A:)
    maskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhen
    vkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanptgislik
    gvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkel
    mqtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafak
    lfcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgp
    etarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpqA (A:)
    askkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhenv
    kylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanptgislikg
    vdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkelm
    qtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafakl
    fcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpe
    tarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wpqB (B:)
    maskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhen
    vkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanptgislik
    gvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkel
    mqtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafak
    lfcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgp
    etarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpqB (B:)
    askkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhenv
    kylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanptgislikg
    vdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkelm
    qtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafakl
    fcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpe
    tarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm