PDB entry 1wpo

View 1wpo on RCSB PDB site
Description: hydrolytic enzyme human cytomegalovirus protease
Class: Viral protein, hydrolase
Keywords: COAT PROTEIN, HYDROLASE, SERINE PROTEASE, PHOSPHORYLATION, VIRAL PROTEASE, Viral protein
Deposited on 1996-07-23, released 1997-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human cytomegalovirus protease
    Species: Human herpesvirus 5 [TaxId:10359]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16753 (Start-255)
      • conflict (74)
      • engineered (180)
      • engineered (228)
      • modified residue (74)
    Domains in SCOPe 2.07: d1wpoa_
  • Chain 'B':
    Compound: human cytomegalovirus protease
    Species: Human herpesvirus 5 [TaxId:10359]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16753 (Start-255)
      • conflict (74)
      • engineered (180)
      • engineered (228)
      • modified residue (74)
    Domains in SCOPe 2.07: d1wpob_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wpoA (A:)
    mtmdeqqsqavapvyvggflarydqspdeaelllprdvvehwlhaqgqgqpslsvalpln
    inhddtavvghvaamqsvrdglfclgcvtsprfleivrrasekselvsrgpvsplqpdkv
    veflsgsyaglslssrrcddveaatslsgsettpfkhvalcsvgrrrgtlavygrdpewv
    mqrfpdltaadrdglraqwqrcgstavdasgdpfrsdsygllgnsvdamyirerlpklry
    dkqlvgvteresyvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpoA (A:)
    qavapvyvggflarydqsllprdvvehwlhavalplninhddtavvghvaamqsvrdglf
    clgcvtsprfleivrrasekselvsrgpvsplqpdkvveflsgsyaglslsstpfkhval
    csvgrrrgtlavygrdpewvmqrfpdltaadrdglraqwqrgdpfrsdsygllgnsvdam
    yirerlpklrydkqlvgvteresyvka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wpoB (B:)
    mtmdeqqsqavapvyvggflarydqspdeaelllprdvvehwlhaqgqgqpslsvalpln
    inhddtavvghvaamqsvrdglfclgcvtsprfleivrrasekselvsrgpvsplqpdkv
    veflsgsyaglslssrrcddveaatslsgsettpfkhvalcsvgrrrgtlavygrdpewv
    mqrfpdltaadrdglraqwqrcgstavdasgdpfrsdsygllgnsvdamyirerlpklry
    dkqlvgvteresyvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wpoB (B:)
    avapvyvggflarydqspdeaelllprdvvehwlhalsvalplninhddtavvghvaamq
    svrdglfclgcvtsprfleivrrasekselvsrgpvsplqpdkvveflsgsyaglslssf
    khvalcsvgrrrgtlavygrdpewvmqrfpdltaadrdglraqwqrgdpfrsdsygllgn
    svdamyirerlpklrydkqlvgvteresyvka