PDB entry 1wpk

View 1wpk on RCSB PDB site
Description: Methylated Form of N-terminal Transcriptional Regulator Domain of Escherichia Coli Ada Protein
Deposited on 2004-09-07, released 2005-09-13
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ada regulatory protein
    Species: Escherichia coli [TaxId:562]
    Gene: ADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06134 (0-145)
      • modified residue (37)
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wpkA (A:)
    mkkatcltddqrwqsvlardpnadgefvfavrttgifcrpscrarhalrenvsfyanase
    alaagfrpckrcqpekanaqqhrldkithacrlleqetpvtlealadqvamspfhlhrlf
    kattgmtpkawqqawrarrlreslak