PDB entry 1wpi

View 1wpi on RCSB PDB site
Description: Solution NMR Structure of Protein YKR049C from Saccharomyces cerevisiae. Ontario Centre for Structural Proteomics target YST0250_1_133; Northeast Structural Genomics Consortium YTYst250
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, OCSP, NESG, PROTEIN STRUCTURE INITIATIVE, PSI-2, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2004-09-03, released 2005-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical 15.6 kDa protein in NAP1-TRK2 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ykr049c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpia1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wpiA (A:)
    msfwktlqrqprtislftndiasniksqkclqllkgdvshrfdveianrfptwdqlqymr
    tscpqgpvslqrqipkldsvlkykhtdptfgmdlqkcvqrglwnpkealwvdwenklvgn
    epadidkyiiqrk