PDB entry 1wpd

View 1wpd on RCSB PDB site
Description: Evidence for domain-specific recognition of SK and Kv channels by MTX and HsTx1 scorpion toxins
Class: toxin
Keywords: Neurotoxin, chimera
Deposited on 2004-09-01, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MTx-HsTx1
    Species: Scorpio maurus palmatus, Heterometrus spinifer [TaxId:53957,118530]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wpdA (A:)
    vsctgskdcyapcrkqtgcpygkcmnrkckcnrc