PDB entry 1wpd

View 1wpd on RCSB PDB site
Description: Evidence for domain-specific recognition of SK and Kv channels by MTX and HsTx1 scorpion toxins
Class: toxin
Keywords: Neurotoxin, chimera, TOXIN
Deposited on 2004-09-01, released 2004-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel toxin alpha-KTx 6.2,Potassium channel toxin alpha-KTx 6.3
    Species: Heterometrus spinifer [TaxId:118530]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wpda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wpdA (A:)
    vsctgskdcyapcrkqtgcpygkcmnrkckcnrc