PDB entry 1wp9

View 1wp9 on RCSB PDB site
Description: Crystal structure of Pyrococcus furiosus Hef helicase domain
Class: hydrolase
Keywords: Helicase, ATPase, DNA replication, DNA repair, DNA recombination
Deposited on 2004-08-31, released 2005-02-01
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.257
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase, putative
    Species: Pyrococcus furiosus DSM 3638
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wp9a1, d1wp9a2
  • Chain 'B':
    Compound: ATP-dependent RNA helicase, putative
    Species: Pyrococcus furiosus DSM 3638
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ATP-dependent RNA helicase, putative
    Species: Pyrococcus furiosus DSM 3638
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ATP-dependent RNA helicase, putative
    Species: Pyrococcus furiosus DSM 3638
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: ATP-dependent RNA helicase, putative
    Species: Pyrococcus furiosus DSM 3638
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: ATP-dependent RNA helicase, putative
    Species: Pyrococcus furiosus DSM 3638
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wp9A (A:)
    mvlrrdliqpriyqeviyakcketnclivlptglgktliammiaeyrltkyggkvlmlap
    tkplvlqhaesfrrlfnlppekivaltgekspeerskawarakvivatpqtiendllagr
    isledvslivfdeahravgnyayvfiareykrqaknplvigltaspgstpekimevinnl
    giehieyrsenspdvrpyvkgirfewvrvdlpeiykevrkllremlrdalkplaetglle
    ssspdipkkevlragqiineemakgnhdlrglllyhamalklhhaielletqglsalray
    ikklyeeakagstkaskeifsdkrmkkaisllvqakeigldhpkmdklkeiireqlqrkq
    nskiivftnyretakkivnelvkdgikakrfvgqaskendrglsqreqklildefargef
    nvlvatsvgeegldvpevdlvvfyepvpsairsiqrrgrtgrhmpgrviilmakgtrdea
    yywssrqkekimqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wp9A (A:)
    mvlrrdliqpriyqeviyakcketnclivlptglgktliammiaeyrltkyggkvlmlap
    tkplvlqhaesfrrlfnlppekivaltgekspeerskawarakvivatpqtiendllagr
    isledvslivfdeahravgnyayvfiareykrqaknplvigltaspgstpekimevinnl
    giehieyrsenspdvrpyvkgirfewvrvdlpeiykevrkllremlrdalkplaetglle
    ssspdipkkevlragqiineemakgnhdlrglllyhamalklhhaielletqglsalray
    ikklyeeakagstkaskeifsdkrmkkaisllvqakeigldhpkmdklkeiireqlqrkq
    nskiivftnyretakkivnelvkdgikakrfvgqaskqreqklildefargefnvlvats
    vgeegldvpevdlvvfyepvpsairsiqrrgrtgrhmpgrviilmakgtrdeayywssr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.