PDB entry 1wp8

View 1wp8 on RCSB PDB site
Description: crystal structure of hendra virus fusion core
Deposited on 2004-08-31, released 2005-11-15
The last revision was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fusion glycoprotein F0,Fusion glycoprotein F0
    Species: HENDRA VIRUS [TaxId:63330]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Fusion glycoprotein F0,Fusion glycoprotein F0
    Species: HENDRA VIRUS [TaxId:63330]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Fusion glycoprotein F0,Fusion glycoprotein F0
    Species: HENDRA VIRUS [TaxId:63330]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wp8A (A:)
    amknadninklkssiestneavvklqetaektvyvltalqdyggsggsggkvdissqiss
    mnqslqqskdyikeaqkildtvnhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1wp8A (A:)
    ninklkssiestneavvklqetaektvyvltalqdissqissmnqslqqskdyikeaqki
    ldtv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wp8B (B:)
    amknadninklkssiestneavvklqetaektvyvltalqdyggsggsggkvdissqiss
    mnqslqqskdyikeaqkildtvnhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1wp8B (B:)
    ninklkssiestneavvklqetaektvyvltalvdissqissmnqslqqskdyikeaqki
    ldtv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1wp8C (C:)
    amknadninklkssiestneavvklqetaektvyvltalqdyggsggsggkvdissqiss
    mnqslqqskdyikeaqkildtvnhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1wp8C (C:)
    ninklkssiestneavvklqetaektvyvltalqdssqissmnqslqqskdyikeaqkil
    dtv