PDB entry 1wp6

View 1wp6 on RCSB PDB site
Description: Crystal structure of maltohexaose-producing amylase from alkalophilic Bacillus sp.707.
Class: hydrolase
Keywords: Alpha-Amylase, Maltohexaose, HYDROLASE
Deposited on 2004-08-31, released 2004-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.166
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucan 1,4-alpha-maltohexaosidase
    Species: Bacillus sp. [TaxId:1416]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wp6a1, d1wp6a2
  • Heterogens: CA, NA, PO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wp6A (A:)
    hhngtngtmmqyfewylpndgnhwnrlnsdasnlkskgitavwippawkgasqndvgyga
    ydlydlgefnqkgtvrtkygtrsqlqaavtslknngiqvygdvvmnhkggadatemvrav
    evnpnnrnqevtgeytieawtrfdfpgrgnthssfkwrwyhfdgvdwdqsrrlnnriykf
    rghgkawdwevdtengnydylmyadidmdhpevvnelrnwgvwytntlgldgfridavkh
    ikysftrdwinhvrsatgknmfavaefwkndlgaienylqktnwnhsvfdvplhynlyna
    sksggnydmrnifngtvvqrhpshavtfvdnhdsqpeealesfveewfkplayaltltre
    qgypsvfygdyygipthgvpamrskidpilearqkyaygkqndyldhhniigwtregnta
    hpnsglatimsdgaggskwmfvgrnkagqvwsditgnrtgtvtinadgwgnfsvnggsvs
    iwvnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wp6A (A:)
    tngtmmqyfewylpndgnhwnrlnsdasnlkskgitavwippawkgasqndvgygaydly
    dlgefnqkgtvrtkygtrsqlqaavtslknngiqvygdvvmnhkggadatemvravevnp
    nnrnqevtgeytieawtrfdfpgrgnthssfkwrwyhfdgvdwdqsrrlnnriykfrghg
    kawdwevdtengnydylmyadidmdhpevvnelrnwgvwytntlgldgfridavkhikys
    ftrdwinhvrsatgknmfavaefwkndlgaienylqktnwnhsvfdvplhynlynasksg
    gnydmrnifngtvvqrhpshavtfvdnhdsqpeealesfveewfkplayaltltreqgyp
    svfygdyygipthgvpamrskidpilearqkyaygkqndyldhhniigwtregntahpns
    glatimsdgaggskwmfvgrnkagqvwsditgnrtgtvtinadgwgnfsvnggsvsiwvn
    k