PDB entry 1wp4

View 1wp4 on RCSB PDB site
Description: Structure of TT368 protein from Thermus Thermophilus HB8
Class: oxidoreductase
Keywords: Hydroxyisobutyrate, NADP, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-08-30, released 2005-08-30
The last revision prior to the SCOP 1.75 freeze date was dated 2005-09-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wp4a1, d1wp4a2
  • Chain 'B':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wp4b1, d1wp4b2
  • Chain 'C':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wp4c1, d1wp4c2
  • Chain 'D':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wp4d1, d1wp4d2
  • Heterogens: SO4, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wp4A (A:)
    mekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvif
    tclpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggt
    sgaeagtltvmlggpeeavervrpflayakkvvhvgpvgaghavkainnallavnlwaag
    egllalvkqgvsaekalevinassgrsnatenlipqrvltrafpktfalgllvkdlgiam
    gvldgekapspllrlarevyemakrelgpdadhvealrllerwggveir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wp4A (A:)
    ekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvift
    clpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggts
    gaeagtltvmlggpeeavervrpflayakkvvhvgpvgaghavkainnallavnlwaage
    gllalvkqgvsaekalevinassgrsnatenlipqrvltrafpktfalgllvkdlgiamg
    vldgekapspllrlarevyemakrelgpdadhvealrllerwggveir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wp4B (B:)
    mekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvif
    tclpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggt
    sgaeagtltvmlggpeeavervrpflayakkvvhvgpvgaghavkainnallavnlwaag
    egllalvkqgvsaekalevinassgrsnatenlipqrvltrafpktfalgllvkdlgiam
    gvldgekapspllrlarevyemakrelgpdadhvealrllerwggveir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wp4B (B:)
    ekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvift
    clpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggts
    gaeagtltvmlggpeeavervrpflayakkvvhvgpvgaghavkainnallavnlwaage
    gllalvkqgvsaekalevinassgrsnatenlipqrvltrafpktfalgllvkdlgiamg
    vldgekapspllrlarevyemakrelgpdadhvealrllerwggveir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wp4C (C:)
    mekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvif
    tclpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggt
    sgaeagtltvmlggpeeavervrpflayakkvvhvgpvgaghavkainnallavnlwaag
    egllalvkqgvsaekalevinassgrsnatenlipqrvltrafpktfalgllvkdlgiam
    gvldgekapspllrlarevyemakrelgpdadhvealrllerwggveir
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wp4D (D:)
    mekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvif
    tclpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggt
    sgaeagtltvmlggpeeavervrpflayakkvvhvgpvgaghavkainnallavnlwaag
    egllalvkqgvsaekalevinassgrsnatenlipqrvltrafpktfalgllvkdlgiam
    gvldgekapspllrlarevyemakrelgpdadhvealrllerwggveir