PDB entry 1wp1

View 1wp1 on RCSB PDB site
Description: Crystal structure of the drug-discharge outer membrane protein, OprM
Class: membrane protein
Keywords: beta barrel, membrane protein
Deposited on 2004-08-28, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.255
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer membrane protein oprM
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: oprM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wp1a_
  • Chain 'B':
    Compound: Outer membrane protein oprM
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: oprM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wp1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wp1A (A:)
    cslipdyqrpeapvaaaypqgqaygqntgaaavpaadigwreffrdpqlqqligvalenn
    rdlrvaalnveafraqyriqradlfprigvdgsgtrqrlpgdlsttgspaissqygvtlg
    ttaweldlfgrlrslrdqaleqylateqaqrsaqttlvasvatayltlkadqaqlqltkd
    tlgtyqksfdltqrsydvgvasaldlrqaqtavegaratlaqytrlvaqdqnalvlllgs
    gipanlpqglgldqtlltevpaglpsdllqrrpdileaehqlmaanasigaaraaffpsi
    sltanagtmsrqlsglfdagsgswlfqpsinlpiftagslrasldyakiqkdinvaqyek
    aiqtafqevadglaargtfteqlqaqrdlvkasdeyyqladkryrtgvdnyltlldaqrs
    lftaqqqlitdrlnqltsevnlykalgggwnqqtvtqqqtakkedpqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wp1A (A:)
    cslipdyqrpeapvaaaypqgqaygqntgaaavpaadigwreffrdpqlqqligvalenn
    rdlrvaalnveafraqyriqradlfprigvdgsgtrqrlpgdlsttgspaissqygvtlg
    ttaweldlfgrlrslrdqaleqylateqaqrsaqttlvasvatayltlkadqaqlqltkd
    tlgtyqksfdltqrsydvgvasaldlrqaqtavegaratlaqytrlvaqdqnalvlllgs
    gipanlpqglgldqtlltevpaglpsdllqrrpdileaehqlmaanasigaaraaffpsi
    sltanagtmsrqlsglfdagsgswlfqpsinlpiftagslrasldyakiqkdinvaqyek
    aiqtafqevadglaargtfteqlqaqrdlvkasdeyyqladkryrtgvdnyltlldaqrs
    lftaqqqlitdrlnqltsevnlykalgggwnqqtvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wp1B (B:)
    cslipdyqrpeapvaaaypqgqaygqntgaaavpaadigwreffrdpqlqqligvalenn
    rdlrvaalnveafraqyriqradlfprigvdgsgtrqrlpgdlsttgspaissqygvtlg
    ttaweldlfgrlrslrdqaleqylateqaqrsaqttlvasvatayltlkadqaqlqltkd
    tlgtyqksfdltqrsydvgvasaldlrqaqtavegaratlaqytrlvaqdqnalvlllgs
    gipanlpqglgldqtlltevpaglpsdllqrrpdileaehqlmaanasigaaraaffpsi
    sltanagtmsrqlsglfdagsgswlfqpsinlpiftagslrasldyakiqkdinvaqyek
    aiqtafqevadglaargtfteqlqaqrdlvkasdeyyqladkryrtgvdnyltlldaqrs
    lftaqqqlitdrlnqltsevnlykalgggwnqqtvtqqqtakkedpqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wp1B (B:)
    cslipdyqrpeapvaaaypqgqaygqntgaaavpaadigwreffrdpqlqqligvalenn
    rdlrvaalnveafraqyriqradlfprigvdtaweldlfgrlrslrdqaleqylateqaq
    rsaqttlvasvatayltlkadqaqlqltkdtlgtyqksfdltqrsydvgvasaldlrqaq
    tavegaratlaqytrlvaqdqnalvlllgsgipanlpqglgldqtlltevpaglpsdllq
    rrpdileaehqlmaanasigaaraaffpsisltswlfqpsinlpifslrasldyakiqkd
    invaqyekaiqtafqevadglaargtfteqlqaqrdlvkasdeyyqladkryrtgvdnyl
    tlldaqrslftaqqqlitdrlnqltsevnlykalgggwnqqtvtq