PDB entry 1wp0

View 1wp0 on RCSB PDB site
Description: Human SCO1
Class: chaperone
Keywords: Cu-binding protein, mitochondrial assembly factor, redox, CHAPERONE
Deposited on 2004-08-27, released 2005-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SCO1 protein homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75880 (1-End)
      • modified residue (43)
      • modified residue (127)
      • modified residue (157)
    Domains in SCOPe 2.08: d1wp0a1
  • Chain 'B':
    Compound: SCO1 protein homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75880 (1-End)
      • initiating methionine (0)
      • modified residue (43)
      • modified residue (127)
      • modified residue (157)
    Domains in SCOPe 2.08: d1wp0b_
  • Chain 'C':
    Compound: SCO1 protein homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75880 (1-End)
      • initiating methionine (0)
      • modified residue (43)
      • modified residue (127)
      • modified residue (157)
    Domains in SCOPe 2.08: d1wp0c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wp0A (A:)
    mgpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeidsittlpdl
    tplfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspgpkdededy
    ivdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpyrkks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wp0A (A:)
    gpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeidsittlpdlt
    plfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspgpkdededyi
    vdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wp0B (B:)
    mgpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeidsittlpdl
    tplfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspgpkdededy
    ivdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpyrkks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wp0B (B:)
    mgpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeidsittlpdl
    tplfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspgpkdededy
    ivdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wp0C (C:)
    mgpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeidsittlpdl
    tplfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspgpkdededy
    ivdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpyrkks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wp0C (C:)
    mgpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeidsittlpdl
    tplfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspgpkdededy
    ivdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpy