PDB entry 1woy

View 1woy on RCSB PDB site
Description: Crystal structure of methionyl tRNA synthetase Y225F mutant from Thermus thermophilus
Class: Ligase
Keywords: Ligase, Metal-binding, class 1a aminoacyl-tRNA synthetase, Rossmann fold, mutation at Tyr225, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-08-27, released 2005-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23395 (0-499)
      • engineered (224)
    Domains in SCOPe 2.07: d1woya1, d1woya2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1woyA (A:)
    mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa
    qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg
    eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl
    irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtfvwfdallnyvsaldy
    pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk
    tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryeadladdlgnlvqrt
    ramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeamayvkalnryine
    kkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralglkeevrleeaer
    wglaeprpipeeapvlfpkk