PDB entry 1wow

View 1wow on RCSB PDB site
Description: Crystal structure of heme oxygenase-2 from Synechocystis sp. PCC 6803 complexed with heme in ferrous form
Class: oxidoreductase
Keywords: reduced form, oxidoreductase
Deposited on 2004-08-26, released 2005-03-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 2
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wowa_
  • Chain 'B':
    Compound: Heme oxygenase 2
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wowb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wowA (A:)
    mtnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhr
    dneiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepelli
    ahcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlns
    lpldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgstearsta
    ghpitlmvge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wowA (A:)
    tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
    neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
    hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
    pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgsteaghpit
    lmvge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wowB (B:)
    mtnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhr
    dneiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepelli
    ahcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlns
    lpldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgstearsta
    ghpitlmvge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wowB (B:)
    tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
    neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
    hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
    pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgstepitlmv
    ge