PDB entry 1wos

View 1wos on RCSB PDB site
Description: Crystal Structure of T-protein of the Glycine Cleavage System
Deposited on 2004-08-24, released 2004-09-07
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.218
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wosA (A:)
    mkrtplfekhvelgakmvdfagwemplyytsifeevmavrksvgmfdvshmgeflvkgpe
    avsfidflitndfsslpdgkaiysvmcnenggiiddlvvykvspdealmvvnaaniekdf
    nwikshsknfdvevsnisdttaliafqgpkaqetlqelvedgleeiayysfrksivagve
    tlvsrtgytgedgfelmleaknapkvwdalmnllrkidgrpaglgardvcrleatyllyg
    qdmdentnpfevglswvvklnkdfvgkeallkakekverklvalelsgkriarkgyevlk
    ngervgeitsgnfsptlgksialalvsksvkigdqlgvvfpggklvealvvkkpfyrgsv
    rrev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wosA (A:)
    mkrtplfekhvelgakmvdfagwemplyytsifeevmavrksvgmfdvshmgeflvkgpe
    avsfidflitndfsslpdgkaiysvmcnenggiiddlvvykvspdealmvvnaaniekdf
    nwikshsknfdvevsnisdttaliafqgpkaqetlqelvedgleeiayysfrksivagve
    tlvsrtgytgedgfelmleaknapkvwdalmnllrkidgrpaglgardvcrleatyllyg
    qdmdentnpfevglswvvklnkdfvgkeallkakekverklvalelsgkriarkgyevlk
    ngervgeitsgnfsptlgksialalvsksvkigdqlgvvfpggklvealvvkkpfyrgsv
    r