PDB entry 1wos

View 1wos on RCSB PDB site
Description: Crystal Structure of T-protein of the Glycine Cleavage System
Class: transferase
Keywords: aminomethyltransferase, T-protein
Deposited on 2004-08-24, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.218
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminomethyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wosa1, d1wosa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wosA (A:)
    mkrtplfekhvelgakmvdfagwemplyytsifeevmavrksvgmfdvshmgeflvkgpe
    avsfidflitndfsslpdgkaiysvmcnenggiiddlvvykvspdealmvvnaaniekdf
    nwikshsknfdvevsnisdttaliafqgpkaqetlqelvedgleeiayysfrksivagve
    tlvsrtgytgedgfelmleaknapkvwdalmnllrkidgrpaglgardvcrleatyllyg
    qdmdentnpfevglswvvklnkdfvgkeallkakekverklvalelsgkriarkgyevlk
    ngervgeitsgnfsptlgksialalvsksvkigdqlgvvfpggklvealvvkkpfyrgsv
    rrev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wosA (A:)
    mkrtplfekhvelgakmvdfagwemplyytsifeevmavrksvgmfdvshmgeflvkgpe
    avsfidflitndfsslpdgkaiysvmcnenggiiddlvvykvspdealmvvnaaniekdf
    nwikshsknfdvevsnisdttaliafqgpkaqetlqelvedgleeiayysfrksivagve
    tlvsrtgytgedgfelmleaknapkvwdalmnllrkidgrpaglgardvcrleatyllyg
    qdmdentnpfevglswvvklnkdfvgkeallkakekverklvalelsgkriarkgyevlk
    ngervgeitsgnfsptlgksialalvsksvkigdqlgvvfpggklvealvvkkpfyrgsv
    r