PDB entry 1woq

View 1woq on RCSB PDB site
Description: Crystal Structure of Inorganic Polyphosphate/ATP-Glucomannokinase From Arthrobacter sp. strain KM At 1.8 A Resolution
Deposited on 2004-08-24, released 2004-09-28
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1woqA (A:)
    makkdekshknapligidiggtgikggivdlkkgkllgerfrvptpqpatpesvaeaval
    vvaelsarpeapaagspvgvtfpgiiqhgvvhsaanvdkswlntdidalltarlgrpvev
    indadaaglaearygagagvkgtvlvitlgtgigsafifdgklvpnaelghleidghdae
    tkasavarerdglswdeysvllqryfshveflfspelfivgggiskradeylpnlrlrtp
    ivpavlrneagivgaaieialqhklak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1woqA (A:)
    napligidiggtgikggivdlkkgkllgerfrvptpqpatpesvaeavalvvaelsarpe
    apaagspvgvtfpgiiqhgvvhsaanvdkswlntdidalltarlgrpvevindadaagla
    earygagagvkgtvlvitlgtgigsafifdgklvpnaelghleidghdaetkasavarer
    dglswdeysvllqryfshveflfspelfivgggiskradeylpnlrlrtpivpavlrnea
    givgaaieialqh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1woqB (B:)
    makkdekshknapligidiggtgikggivdlkkgkllgerfrvptpqpatpesvaeaval
    vvaelsarpeapaagspvgvtfpgiiqhgvvhsaanvdkswlntdidalltarlgrpvev
    indadaaglaearygagagvkgtvlvitlgtgigsafifdgklvpnaelghleidghdae
    tkasavarerdglswdeysvllqryfshveflfspelfivgggiskradeylpnlrlrtp
    ivpavlrneagivgaaieialqhklak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1woqB (B:)
    napligidiggtgikggivdlkkgkllgerfrvptpqpatpesvaeavalvvaelsarpe
    apaagspvgvtfpgiiqhgvvhsaanvdkswlntdidalltarlgrpvevindadaagla
    earygagagvkgtvlvitlgtgigsafifdgklvpnaelghleidghdaetkasavarer
    dglswdeysvllqryfshveflfspelfivgggiskradeylpnlrlrtpivpavlrnea
    givgaaieialqh