PDB entry 1woq

View 1woq on RCSB PDB site
Description: Crystal Structure of Inorganic Polyphosphate/ATP-Glucomannokinase From Arthrobacter sp. strain KM At 1.8 A Resolution
Class: transferase
Keywords: polyphosphate, glucomannokinase, TRANSFERASE
Deposited on 2004-08-24, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inorganic polyphosphate/ATP-glucomannokinase
    Species: Arthrobacter sp. [TaxId:184230]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1woqa1, d1woqa2
  • Chain 'B':
    Compound: Inorganic polyphosphate/ATP-glucomannokinase
    Species: Arthrobacter sp. [TaxId:184230]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1woqb1, d1woqb2
  • Heterogens: BGC, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1woqA (A:)
    makkdekshknapligidiggtgikggivdlkkgkllgerfrvptpqpatpesvaeaval
    vvaelsarpeapaagspvgvtfpgiiqhgvvhsaanvdkswlntdidalltarlgrpvev
    indadaaglaearygagagvkgtvlvitlgtgigsafifdgklvpnaelghleidghdae
    tkasavarerdglswdeysvllqryfshveflfspelfivgggiskradeylpnlrlrtp
    ivpavlrneagivgaaieialqhklak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1woqA (A:)
    napligidiggtgikggivdlkkgkllgerfrvptpqpatpesvaeavalvvaelsarpe
    apaagspvgvtfpgiiqhgvvhsaanvdkswlntdidalltarlgrpvevindadaagla
    earygagagvkgtvlvitlgtgigsafifdgklvpnaelghleidghdaetkasavarer
    dglswdeysvllqryfshveflfspelfivgggiskradeylpnlrlrtpivpavlrnea
    givgaaieialqh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1woqB (B:)
    makkdekshknapligidiggtgikggivdlkkgkllgerfrvptpqpatpesvaeaval
    vvaelsarpeapaagspvgvtfpgiiqhgvvhsaanvdkswlntdidalltarlgrpvev
    indadaaglaearygagagvkgtvlvitlgtgigsafifdgklvpnaelghleidghdae
    tkasavarerdglswdeysvllqryfshveflfspelfivgggiskradeylpnlrlrtp
    ivpavlrneagivgaaieialqhklak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1woqB (B:)
    napligidiggtgikggivdlkkgkllgerfrvptpqpatpesvaeavalvvaelsarpe
    apaagspvgvtfpgiiqhgvvhsaanvdkswlntdidalltarlgrpvevindadaagla
    earygagagvkgtvlvitlgtgigsafifdgklvpnaelghleidghdaetkasavarer
    dglswdeysvllqryfshveflfspelfivgggiskradeylpnlrlrtpivpavlrnea
    givgaaieialqh