PDB entry 1wop

View 1wop on RCSB PDB site
Description: Crystal Structure of T-protein of the Glycine Cleavage System
Class: transferase
Keywords: Aminomethyltransferase, T-protein, folinic acid
Deposited on 2004-08-24, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminomethyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wopa1, d1wopa2
  • Heterogens: FFO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wopA (A:)
    mkrtplfekhvelgakmvdfagwemplyytsifeevmavrksvgmfdvshmgeflvkgpe
    avsfidflitndfsslpdgkaiysvmcnenggiiddlvvykvspdealmvvnaaniekdf
    nwikshsknfdvevsnisdttaliafqgpkaqetlqelvedgleeiayysfrksivagve
    tlvsrtgytgedgfelmleaknapkvwdalmnllrkidgrpaglgardvcrleatyllyg
    qdmdentnpfevglswvvklnkdfvgkeallkakekverklvalelsgkriarkgyevlk
    ngervgeitsgnfsptlgksialalvsksvkigdqlgvvfpggklvealvvkkpfyrgsv
    rrev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wopA (A:)
    mkrtplfekhvelgakmvdfagwemplyytsifeevmavrksvgmfdvshmgeflvkgpe
    avsfidflitndfsslpdgkaiysvmcnenggiiddlvvykvspdealmvvnaaniekdf
    nwikshsknfdvevsnisdttaliafqgpkaqetlqelvedgleeiayysfrksivagve
    tlvsrtgytgedgfelmleaknapkvwdalmnllrkidgrpaglgardvcrleatyllyg
    qdmdentnpfevglswvvklnkdfvgkeallkakekverklvalelsgkriarkgyevlk
    ngervgeitsgnfsptlgksialalvsksvkigdqlgvvfpggklvealvvkkpfyrgsv
    rr