PDB entry 1wol

View 1wol on RCSB PDB site
Description: Crystal Structure of ST0689, an archaeal HEPN homologue
Class: unknown function
Keywords: alpha helix, loop, unknown function
Deposited on 2004-08-20, released 2005-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.187
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 122aa long conserved hypothetical protein
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wola_
  • Heterogens: TBU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wolA (A:)
    mkrvedwikqaerdleearyaksggyyelacflsqqcaekavkgllqfqgiekrghsish
    lltnppadilqcatfldkqytpsrypdvyyegapyeyyterdadecincairilnwvkgq
    ik