PDB entry 1wok

View 1wok on RCSB PDB site
Description: Crystal structure of catalytic domain of human poly(ADP-ribose) polymerase complexed with a quinoxaline-type inhibitor
Class: transferase
Keywords: protein-inhibitor complex, transferase
Deposited on 2004-08-20, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PPOL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1woka1, d1woka2
  • Chain 'B':
    Compound: Poly [ADP-ribose] polymerase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PPOL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wokb1, d1wokb2
  • Chain 'C':
    Compound: Poly [ADP-ribose] polymerase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PPOL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wokc1, d1wokc2
  • Chain 'D':
    Compound: Poly [ADP-ribose] polymerase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PPOL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wokd1, d1wokd2
  • Heterogens: CNQ

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wokA (A:)
    ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
    qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrgg
    sddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkier
    egecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmv
    sksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsan
    isldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wokB (B:)
    ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
    qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrgg
    sddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkier
    egecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmv
    sksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsan
    isldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wokC (C:)
    ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
    qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrgg
    sddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkier
    egecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmv
    sksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsan
    isldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wokD (D:)
    ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
    qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrgg
    sddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkier
    egecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmv
    sksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsan
    isldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt