PDB entry 1woj

View 1woj on RCSB PDB site
Description: Crystal structure of human phosphodiesterase
Class: Hydrolase
Keywords: Hydrolase
Deposited on 2004-08-19, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2',3'-cyclic-nucleotide 3'-phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1woja_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wojA (A:)
    lplyfgwfltkkssetlrkagqvfleelgnhkafkkelrqfvpgdeprekmdlvtyfgkr
    ppgvlhcttkfcdygkapgaeeyaqqdvlkksyskaftltisalfvtpkttgarvelseq
    qlqlwpsdvdklsptdnlprgsrahitlgcaadveavqtgldlleilrqekggsrgeevg
    elsrgklyslgngrwmltlaknmevraiftgyyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wojA (A:)
    lplyfgwfltkkssetlrkagqvfleelgnhkafkkelrqfvpekmdlvtyfgkrppgvl
    hcttkfcdygkapgaeeyaqqdvlkksyskaftltisalfvtpkttgarvelseqqlqlw
    psdvdklsptdnlprgsrahitlgcaadveavqtgldlleilrqekggsrgeevgelsrg
    klyslgngrwmltlaknmevraiftgyyg