PDB entry 1woh

View 1woh on RCSB PDB site
Description: Crystal Structure of Agmatinase Reveals Structural Conservation and Inhibition Mechanism of the Ureohydrolase Superfamily
Class: hydrolase
Keywords: alpha/beta fold, HYDROLASE
Deposited on 2004-08-18, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.219
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agmatinase
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RZ04 (Start-303)
      • cloning artifact (304)
    Domains in SCOPe 2.07: d1woha1, d1woha2
  • Chain 'B':
    Compound: agmatinase
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RZ04 (Start-303)
      • cloning artifact (304)
    Domains in SCOPe 2.07: d1wohb1, d1wohb2
  • Chain 'C':
    Compound: agmatinase
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RZ04 (Start-303)
      • cloning artifact (304)
    Domains in SCOPe 2.07: d1wohc1, d1wohc2
  • Chain 'D':
    Compound: agmatinase
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RZ04 (Start-303)
      • cloning artifact (304)
    Domains in SCOPe 2.07: d1wohd1, d1wohd2
  • Chain 'E':
    Compound: agmatinase
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RZ04 (Start-303)
      • cloning artifact (304)
    Domains in SCOPe 2.07: d1wohe1, d1wohe2
  • Chain 'F':
    Compound: agmatinase
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RZ04 (Start-303)
      • cloning artifact (304)
    Domains in SCOPe 2.07: d1wohf1, d1wohf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wohA (A:)
    msgpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreasl
    rsvppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggd
    hsvsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvg
    lrglrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipg
    tsspepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcev
    fdhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wohA (A:)
    gpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreaslrs
    vppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggdhs
    vsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvglr
    glrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipgts
    spepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcevfd
    hvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wohB (B:)
    msgpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreasl
    rsvppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggd
    hsvsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvg
    lrglrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipg
    tsspepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcev
    fdhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wohB (B:)
    gpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreaslrs
    vppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggdhs
    vsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvglr
    glrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipgts
    spepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcevfd
    hvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wohC (C:)
    msgpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreasl
    rsvppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggd
    hsvsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvg
    lrglrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipg
    tsspepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcev
    fdhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wohC (C:)
    gpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreaslrs
    vppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggdhs
    vsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvglr
    glrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipgts
    spepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcevfd
    hvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wohD (D:)
    msgpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreasl
    rsvppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggd
    hsvsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvg
    lrglrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipg
    tsspepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcev
    fdhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wohD (D:)
    gpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreaslrs
    vppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggdhs
    vsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvglr
    glrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipgts
    spepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcevfd
    hvl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wohE (E:)
    msgpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreasl
    rsvppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggd
    hsvsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvg
    lrglrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipg
    tsspepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcev
    fdhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wohE (E:)
    gpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreaslrs
    vppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggdhs
    vsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvglr
    glrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipgts
    spepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcevfd
    hvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wohF (F:)
    msgpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreasl
    rsvppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggd
    hsvsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvg
    lrglrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipg
    tsspepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcev
    fdhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wohF (F:)
    gpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreaslrs
    vppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggdhs
    vsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvglr
    glrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipgts
    spepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcevfd
    hvl