PDB entry 1wof

View 1wof on RCSB PDB site
Description: Crystal Structure Of SARS-CoV Mpro in Complex with an Inhibitor N1
Class: Hydrolase
Keywords: ANTI-PARALLEL B-BARREL, ANTI-PARALLEL A-HELICES, Hydrolase
Deposited on 2004-08-18, released 2005-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59641 (5-End)
      • cloning artifact (1-4)
    Domains in SCOPe 2.07: d1wofa1, d1wofa2
  • Chain 'B':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59641 (5-End)
      • cloning artifact (3-4)
    Domains in SCOPe 2.07: d1wofb1, d1wofb2
  • Heterogens: I12, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wofA (A:)
    gplgssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnye
    dllirksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvl
    acyngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagt
    dlegkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvam
    kynyepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfd
    vvrqcsgvtfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wofA (A:)
    plgssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyed
    llirksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvla
    cyngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtd
    legkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamk
    ynyepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdv
    vrqcsgvtf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wofB (B:)
    gplgssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnye
    dllirksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvl
    acyngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagt
    dlegkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvam
    kynyepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfd
    vvrqcsgvtfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wofB (B:)
    gssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedll
    irksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacy
    ngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdle
    gkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkyn
    yepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvr
    qcsg